The ordering process is very simple. Just click the button below to move to the shopping site. After purchase, our qualified team will proceed to the realization of your order. We will try to fulfill your order as soon as possible. We use the services of the best delivery companies, thanks to this your products will reach you quickly, safely and on time.
2283 EUR
1 mg
C804-1000
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLVDHHHHHH
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Recombinant Human PRPS2 is produced by our Mammalian expression system and the target gene encoding Pro2-Leu318 is expressed with a 6His tag at the C-terminus.
Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Greater than 95% as determined by reducing SDS-PAGE.
Recombinants or rec. proteins
Ambient/Room Temperature
recombinants
Human Cells
35,8 kDa
P11908
Human