A simple ordering process

The ordering process is very simple. Just click the button below to move to the shopping site. After purchase, our qualified team will proceed to the realization of your order. We will try to fulfill your order as soon as possible. We use the services of the best delivery companies, thanks to this your products will reach you quickly, safely and on time.

Click and buy on Gentaur

Price

157 EUR

Size

10 ug

Catalog number

C804-10

Details

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Peptide sequence

PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLVDHHHHHH

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Description

Recombinant Human PRPS2 is produced by our Mammalian expression system and the target gene encoding Pro2-Leu318 is expressed with a 6His tag at the C-terminus.

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Source

Recombinants or rec. proteins

Shipping condition

Ambient/Room Temperature

Group

recombinants

Origin

Human cells

Estimated molecular weight

35,8 kDa

UniProt number

P11908

Species reactivity

Human